PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 467aa    MW: 53456.8 Da    PI: 5.3695
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485691.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF801.6e-251058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +ie+ +nrqvtfskRrngilKK +ELSvLCd++va+i+fs++g+l  ys
  XP_016485691.1 10 KIESLTNRQVTFSKRRNGILKKIYELSVLCDVDVAIIMFSPSGRLTHYS 58
                    59********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.703161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-25291IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-22323IPR002100Transcription factor, MADS-box
PfamPF003197.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-223859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MGRSKLPLLK IESLTNRQVT FSKRRNGILK KIYELSVLCD VDVAIIMFSP SGRLTHYSRK  60
RRIEDVLSEL VYLPDSERGF YINNKESVLW NLRKIEIQDK FCDIERISPA YLNTNDTAKK  120
IQEEINGLHC KLEEAEGLLR IFEPDTKKIT SLHELDLCEK RLQVALNQVR QRMEQLSNNH  180
NTSSYEDNME QINALLQYID NTQTEDTKPS LEESPYDLWL ELEDYSYTNY INDNNNSHLY  240
AASETSSLTQ SSMSLSSPII YDAISQTSIS GVTNYHKEGT FSSLTDENFK QSQHSTRTFP  300
TLTLQTSFKF AKPEMETPTS ALRPVAPYLH VEATAACSQQ PVSSDYYKEN NELDCRFQPK  360
VTTSNYQMSQ KRTAEGSFSS LTDESFKQSQ CSTRIFPPIA PLQTSFSFAT PEMETPTSAL  420
RPVAPYLQAE AAASSNQQLP SNNIEEENHE ISWFQPQMKK SKYHHLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755173e-62HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016485691.10.0PREDICTED: agamous-like MADS-box protein AGL104
TrEMBLK4C1L41e-176K4C1L4_SOLLC; Uncharacterized protein
STRINGSolyc05g051830.2.11e-176(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130701416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-43AGAMOUS-like 104